PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G00741.1.p
Common NameEUGRSUZ_G00741
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 106aa    MW: 12155.9 Da    PI: 8.743
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G00741.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR151.24e-161296289
              FAR1  2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89
                       Yn+YA + GF vrk ++ ++  ++   + tf  ++eg++ + + + e+     +++rtgC+a+++ k e +g+w v+k++  HnH++
  Eucgr.G00741.1.p 12 TYNAYAISKGFGVRKGQKANN-CKRILRTCTFFRNCEGHSPPISPH-EQIDVYMTVKRTGCEACITFKIE-NGVWIVDKFKDVHNHPF 96
                      6***************99988.555588889999*****9999888.9999******************9.***************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.1E-131296IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MTFANEDEAY KTYNAYAISK GFGVRKGQKA NNCKRILRTC TFFRNCEGHS PPISPHEQID  60
VYMTVKRTGC EACITFKIEN GVWIVDKFKD VHNHPFIDDK QKHLI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G00741.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A059BB541e-75A0A059BB54_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1499737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G80010.16e-09FAR1-related sequence 8